PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID Ciclev10026455m
Common NameCICLE_v10026457mg
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; rosids; malvids; Sapindales; Rutaceae; Aurantioideae; Citrus
Family MIKC_MADS
Protein Properties Length: 218aa    MW: 24675 Da    PI: 6.54
Description MIKC_MADS family protein
Gene Model
Gene Model ID Type Source Coding Sequence
Ciclev10026455mgenomeICGCView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1SRF-TF91.15.6e-29959151
                     S---SHHHHHHHHHHHHHHHHHHHHHHHHHHT-EEEEEEE-TTSEEEEEE- CS
           SRF-TF  1 krienksnrqvtfskRrngilKKAeELSvLCdaevaviifsstgklyeyss 51
                     k+i+n + rqvtfskRr gi+KKAeELSvLCda+va+iifs tgkl+eyss
  Ciclev10026455m  9 KKIDNATARQVTFSKRRRGIFKKAEELSVLCDADVALIIFSATGKLFEYSS 59
                     68***********************************************96 PP

2K-box46.91.2e-1610617333100
            K-box  33 reqRhllGedLesLslkeLqqLeqqLekslkkiRskKnellleqieelqkkekelqeenkaLrkklee 100
                      + +R++ Ge+++ Lsl+eLq+Le+ Le +l ++ +kK+e ++++i+elq++ k l een++Lr++++e
  Ciclev10026455m 106 HLLRQMRGEEIHGLSLEELQRLERSLEVGLGRVIEKKEEKITKEINELQRRGKLLMEENERLRQQVAE 173
                      557**************************************************************986 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
PROSITE profilePS5006630.291161IPR002100Transcription factor, MADS-box
SMARTSM004329.8E-40160IPR002100Transcription factor, MADS-box
CDDcd002653.62E-39277No hitNo description
SuperFamilySSF554552.88E-31381IPR002100Transcription factor, MADS-box
PRINTSPR004043.9E-27323IPR002100Transcription factor, MADS-box
PROSITE patternPS003500357IPR002100Transcription factor, MADS-box
PfamPF003193.3E-251057IPR002100Transcription factor, MADS-box
PRINTSPR004043.9E-272338IPR002100Transcription factor, MADS-box
PRINTSPR004043.9E-273859IPR002100Transcription factor, MADS-box
PROSITE profilePS5129712.98587177IPR002487Transcription factor, K-box
PfamPF014865.2E-1491171IPR002487Transcription factor, K-box
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0009266Biological Processresponse to temperature stimulus
GO:0009910Biological Processnegative regulation of flower development
GO:0010076Biological Processmaintenance of floral meristem identity
GO:0010582Biological Processfloral meristem determinacy
GO:0030154Biological Processcell differentiation
GO:0045892Biological Processnegative regulation of transcription, DNA-templated
GO:0048438Biological Processfloral whorl development
GO:0005634Cellular Componentnucleus
GO:0000900Molecular Functiontranslation repressor activity, nucleic acid binding
GO:0003677Molecular FunctionDNA binding
GO:0003700Molecular Functiontranscription factor activity, sequence-specific DNA binding
GO:0046983Molecular Functionprotein dimerization activity
Sequence ? help Back to Top
Protein Sequence    Length: 218 aa     Download sequence    Send to blast
MAREKIQIKK IDNATARQVT FSKRRRGIFK KAEELSVLCD ADVALIIFSA TGKLFEYSSS  60
SMKEILEKHR VHSKNLERVD QPSVELQLLE NNNYSMLFKE AAEKSHLLRQ MRGEEIHGLS  120
LEELQRLERS LEVGLGRVIE KKEEKITKEI NELQRRGKLL MEENERLRQQ VAEVSNAYGE  180
EGQSSESVNN ICNSSNAPPP ESESSDTSLK LGLPYAG*
3D Structure ? help Back to Top
Structure
PDB ID Evalue Query Start Query End Hit Start Hit End Description
1tqe_P6e-20173173Myocyte-specific enhancer factor 2B
1tqe_Q6e-20173173Myocyte-specific enhancer factor 2B
1tqe_R6e-20173173Myocyte-specific enhancer factor 2B
1tqe_S6e-20173173Myocyte-specific enhancer factor 2B
Search in ModeBase
Binding Motif ? help Back to Top
Motif ID Method Source Motif file
MP00272DAPTransfer from AT2G22540Download
Motif logo
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieveRetrieve
Annotation -- Nucleotide ? help Back to Top
Source Hit ID E-value Description
GenBankFJ3732100.0FJ373210.1 Poncirus trifoliata SVP-like protein mRNA, complete cds.
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_006426275.11e-156hypothetical protein CICLE_v10026457mg
RefseqXP_006426276.11e-156hypothetical protein CICLE_v10026457mg
SwissprotQ9FUY61e-107JOIN_SOLLC; MADS-box protein JOINTLESS
TrEMBLV4SKX11e-156V4SKX1_9R
STRINGVIT_00s0313g00070.t011e-112(Vitis vinifera)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
MalvidsOGEM41902747
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT2G22540.13e-81MIKC_MADS family protein